Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
English English Default Default
£0.00
rats
CUSTOM Double hammock, rat or syrian hamster, cotton and f..
CUSTOM Double hammock, rat or syrian hamster, cotton and f..
£7.49
Degon Toy Bundle, chew toys, enrichment
Degon Toy Bundle, chew toys, enrichment
£9.99
Double hammock, rat or syrian hamster, lavender guinea pig..
Double hammock, rat or syrian hamster, lavender guinea pig..
£7.49
Rexxus Toy Bundle, chew toys, rats and syrian hamsters
Rexxus Toy Bundle, chew toys, rats and syrian hamsters
£14.99
Small bundle box for rats and syrian hamsters
Small bundle box for rats and syrian hamsters
£14.49
Small Bundle Box for rats and syrian hamsters.
Small Bundle Box for rats and syrian hamsters.
£14.49
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i